{{cart_num}}
My Cart> Peptides > Hormone and Related Peptides > Prolactin-Releasing Peptide (1-31), ratCAS：215510-06-8
Purity：≥95%
Appearance：Lyophilized powder
Storage：Store at -20℃，2 years.(Avoid freeze/thaw cycles)
Qty：
Size：
| Product Type | Peptides |
| CAS | 215510-06-8 |
| Sequence(1LC) | SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 |
| Sequence(3LC) | Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Molecular Formula | C156H242N54O43S1 |
| Molecular Weight | 3594.04 |
| Purity | ≥95% |
| Appearance | Lyophilized powder |
| Salt Form | Trifluoroacetate salt |
| Source | Synthetic |
| Storage | Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
| Category/Label | Hormone and Related Peptides |
| Background | This 25 residue peptide was completely resistant to proteolysis by cathepsin B even after incubation overnight. It inhibited human cathepsin B with Ki = 2.8 μM and rat cathepsin B with Ki = 2 μM. |
| In Vitro | undetected |
| Reference | [1] N.J.Crowther et al., Protein Eng., 7, 137(1994). |
| Unit | Bottle |
| Specification | 1mg 5mg |
Remark：These protocols are for reference only. Solarbio does not independently validate these methods.
Note：
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Sorry, there is no more information.
Manual Download
