Exendin(9-39) amide
Cat.No:CLP1879 Solarbio
CAS:133514-43-9
Molecular Formula:C149H234N40O47S
Molecular Weight:3369.76
Purity:≥95.0%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
{{cart_num}}
My CartCAS:133514-43-9
Molecular Formula:C149H234N40O47S
Molecular Weight:3369.76
Purity:≥95.0%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
Product Type | Peptides |
CAS | 133514-43-9 |
Sequence(1LC) | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Sequence(3LC) | Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
Molecular Formula | C149H234N40O47S |
Molecular Weight | 3369.76 |
Purity | ≥95.0% |
Appearance | Lyophilized powder |
Solubility | Continuous subcutaneous infusion of Avexitide (Exendin (9-39)) significantly raises fasting blood glucose levels in SUR-1 -/- mice without affecting glucose tolerance. |
Salt Form | Trifluoroacetate salt |
Source | Synthetic |
Storage | Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
Category/Label | Hormone and Related Peptides |
Background | Exendin(9-39) amide (Avexitide) is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for binding to GLP-1 receptors, thereby antagonizing the effects of excess GLP-1 secretion. Exendin(9-39) amide can be used to study postoperative hypoglycemia (PBH). |
Reference | [1]. Calabria AC, et al. GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes. 2012 Oct;61(10):2585-91. [2]. De León DD, et al. Exendin-(9-39) corrects fasting hypoglycemia in SUR-1-/- mice by lowering cAMP in pancreatic beta-cells and inhibiting secretion. J Biol Chem. 2008 Sep 19;283(38):25786-93. |
Unit | Bottle |
Specification | 1mg 5mg 10mg |
Remark:These protocols are for reference only. Solarbio does not independently validate these methods.
Note:
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Sorry, there is no more information.