BMAP-28
Cat.No:CLP1221 Solarbio
CAS:184870-31-3
Molecular Formula:C145H250N44O29
Molecular Weight:3073.81
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
{{cart_num}}
My CartCAS:184870-31-3
Molecular Formula:C145H250N44O29
Molecular Weight:3073.81
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
Product Type | Peptides |
CAS | 184870-31-3 |
Sequence(1LC) | GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2 |
Sequence(3LC) | Gly-Gly-Leu-Arg-Ser-Leu-Gly-Arg-Lys-Ile-Leu-Arg-Ala-Trp-Lys-Lys-Tyr-Gly-Pro-Ile-Ile-Val-Pro-Ile-Ile-Arg-Ile-NH2 |
Molecular Formula | C145H250N44O29 |
Molecular Weight | 3073.81 |
Purity | ≥95% |
Appearance | Lyophilized powder |
Salt Form | Trifluoroacetate salt |
Source | Synthetic |
Storage | Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
Category/Label | Virus Related Peptides |
Background | BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer. |
Reference | [1]. Risso A, et al. BMAP-28, an antibiotic peptide of innate immunity, induces cell death through opening of the mitochondrial permeability transition pore. Mol Cell Biol. 2002 Mar;22(6):1926-35. |
Unit | Bottle |
Specification | 1mg 5mg 10mg |
Remark:These protocols are for reference only. Solarbio does not independently validate these methods.
Note:
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Sorry, there is no more information.