{{cart_num}}
My CartPurity：≥95%
Storage：Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days. Aliquots of reconstituted samples are stable at ≤ -20°C for 3 months.
Qty：
Size：
| Solubility | Soluble in water |
| Purity | ≥95% |
| Storage | Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days. Aliquots of reconstituted samples are stable at ≤ -20°C for 3 months. |
| Interval Range | MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQ LESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS* |
| Unit | Piece |
| Specification | 10ug 50ug 500ug 1mg |
Recombinant Human Interleukin-1 beta/IL1B is produced with our E. coli expression system. The target protein is expressed with sequence (Ala117-Ser269) of Human IL1B.
Remark：These protocols are for reference only. Solarbio does not independently validate these methods.
Note：
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Upregulation of β-catenin signaling represents a single common pathway leading to the various phenotypes of spinal degeneration and pain
Click to check >>Author：Lu Ke, Wang Qingyun, Jiang Hua, Li Jun, Yao Zhou, Huang Yongcan, Chen Jianquan, Zhang Yejia, Xiao Guozhi, Hu Xueyu, Luo Zhuojing, Yang Liu, Tong Liping, Chen Di
IF：13.3620
Publish_to：Bone Research
PMID：37059724
Polydopamine-Pd nanozymes as potent ROS scavengers in combination with near-infrared irradiation for osteoarthritis treatment
Click to check >>Author：Hao Hu, Junxu Yang, Yanping Zhong, Jiawei Wang, Jinhong Cai, Cuijuan Luo, Zhiqiang Jin, Ming Gao, Maolin He, Li Zheng
IF：6.1070
Publish_to：iScience
PMID：37182095
